Journal: Nature Communications

Article Title: High-sensitive sensory neurons exacerbate rosacea-like dermatitis in mice by activating γδ T cells directly

doi: 10.1038/s41467-024-50970-1

Figure Lengend Snippet: A Diagram of the experimental paradigm in ( A – E ). capsaicin or vehicle on day −1 before intradermal injection of PBS or LL37 in mice. B, Representative macroscopic images and HE-stained sections of skin tissues. C The redness score, area of erythema and skin thickness of skin tissues ( n = 4 mice for each group). The mRNA levels of rosacea-characteristic factors ( D ) ( n = 6 mice for each group), the CD4 + T cells infiltration and CD31 + microvasculature ( E ) ( n = 4 mice for each group) in the skin of vehicle- or capsaicin-treated mice after LL37/PBS injection. C – E Data represent the mean ± SEM. ns, p > 0.05. Two--way ANOVA test was used, with Bonferroni’s post hoc test.

Article Snippet: The antimicrobial peptide LL37 was synthesized by Sangon Biotech, and the purity of LL37 was 95% by high performance liquid chromatography (HPLC).

Techniques: Injection, Staining

Journal: Nature Communications

Article Title: High-sensitive sensory neurons exacerbate rosacea-like dermatitis in mice by activating γδ T cells directly

doi: 10.1038/s41467-024-50970-1

Figure Lengend Snippet: A Diagram of the experimental paradigm in A – E . Nociceptor ablation and induction of rosacea-like skin inflammation. Mice were treated with DMSO or RTX and rested for 4 weeks and then with capsaicin or vehicle on day -1 before intradermal injection of LL37 in mice. B Representative photo and HE staining. C Redness score, area of erythema and skin thickness ( n = 3 or 4 mice for each group). D mRNA levels of rosacea-characteristic factors ( n = 6 for each group). E CD4 + T cells infiltration and CD31 + microvasculature in the skin of vehicle- or capsaicin-treated RTX mice after LL37 injection. The quantitative analysis of CD4 + T cells and CD31 + microvasculature from pictures originally magnified ×20 ( n = 5 for each group). F Diagram of the experimental paradigm in ( G – J ). Mice were co-administered capsaicin with QX314 (100 μM) on day -1 before intradermal injection of LL37. G Representative photo and HE staining and ( H ) The redness score, area of erythema and skin thickness ( n = 3 or 4 for each group) and ( I ) The mRNA levels of rosacea-characteristic factors ( n = 6 for each group) and ( J ) The CD4 + T cells infiltration and the CD31 + microvascular in the skin of vehicle or capsaicin-treated QX314 mice after LL37 injection ( n = 5 for each group). C – E and H – J Data represent the mean ± SEM. ns, p > 0.05. Two-way ANOVA with Bonferroni’s post hoc test was used.

Article Snippet: The antimicrobial peptide LL37 was synthesized by Sangon Biotech, and the purity of LL37 was 95% by high performance liquid chromatography (HPLC).

Techniques: Injection, Staining

Journal: Nature Communications

Article Title: High-sensitive sensory neurons exacerbate rosacea-like dermatitis in mice by activating γδ T cells directly

doi: 10.1038/s41467-024-50970-1

Figure Lengend Snippet: A Diagram of the experimental paradigm in ( A – E ). Capsaicin or vehicle on day -1 before intradermal injection of PBS or LL37 in WT or Nav1.8-DTR mice. B Representative photo and HE staining and ( C ) The redness score, area of erythema and skin thickness ( n = 5 for each group) and ( D ) The mRNA levels of rosacea-characteristic factors in the skin of vehicle or capsaicin-treated RTX mice after LL37 injection ( n = 4–6 for each group). Data represent the mean ± SEM. ns, p > 0.05. Two-way ANOVA with Bonferroni’s post hoc test was used. E The CD4 + T cells infiltration and the CD31 + microvascular in the skin of vehicle or capsaicin-treated RTX mice after LL37 injection.

Article Snippet: The antimicrobial peptide LL37 was synthesized by Sangon Biotech, and the purity of LL37 was 95% by high performance liquid chromatography (HPLC).

Techniques: Injection, Staining

Journal: Nature Communications

Article Title: High-sensitive sensory neurons exacerbate rosacea-like dermatitis in mice by activating γδ T cells directly

doi: 10.1038/s41467-024-50970-1

Figure Lengend Snippet: A Representative whole-mount image of capsaicin-treated skin from Nav1.8RFP mice with LL37 injection stained for CGRP. B Representative image of CGRP expression in the skin of healthy volunteer (HS) and rosacea patients (Rosacea). C Diagram of the experimental paradigm in (D – G) . Mice were co-administered capsaicin with CGRP 8-37 on day −1 before intradermal injection of PBS or LL37. D Representative photo and HE staining and ( E ) The redness score, area of erythema and skin thickness of skin tissues ( n = 4 or 6 for each group) and ( F ) The mRNA levels of rosacea-characteristic factors ( n = 6 for each group) and ( G ) The CD4 + T cells infiltration and the CD31 + microvascular in the skin of CGRP 8-37 and capsaicin-treated mice after LL37 injection ( n = 5 for each group). Data represent the mean ± SEM. ns, p > 0.05. Two-way ANOVA with Bonferroni’s post hoc test was used.

Article Snippet: The antimicrobial peptide LL37 was synthesized by Sangon Biotech, and the purity of LL37 was 95% by high performance liquid chromatography (HPLC).

Techniques: Injection, Staining, Expressing

Journal: Nature Communications

Article Title: High-sensitive sensory neurons exacerbate rosacea-like dermatitis in mice by activating γδ T cells directly

doi: 10.1038/s41467-024-50970-1

Figure Lengend Snippet: A Diagram of the experimental paradigm in ( A – E ). Mice were treated with CGRP and intradermal injection of PBS or LL37. B Representative photo and HE staining and ( C ) The redness score, area of erythema and skin thickness ( n = 4 for each group) and ( D ) The mRNA levels of rosacea-characteristic factors ( n = 4 for each group) and E , The CD4 + T cells infiltration and the CD31 + microvascular in the skin of vehicle or CGRP-treated mice after LL37 or PBS injection ( n = 4 for each group). C – E Data represent the mean ± SEM. ns, p > 0.05. Two-way ANOVA with Bonferroni’s post hoc test was used.

Article Snippet: The antimicrobial peptide LL37 was synthesized by Sangon Biotech, and the purity of LL37 was 95% by high performance liquid chromatography (HPLC).

Techniques: Injection, Staining

Journal: Nature Communications

Article Title: High-sensitive sensory neurons exacerbate rosacea-like dermatitis in mice by activating γδ T cells directly

doi: 10.1038/s41467-024-50970-1

Figure Lengend Snippet: A Representative FACS plots and quantification of γδ T cells in the skin from rosacea patients and rosacea-like mice ( n = 4 for each group). B Representative macroscopic images and HE-stained sections and ( C ) The redness score, area of erythema and skin thickness of skin tissues in WT or Tcrd −/− mice with LL37 or PBS injection ( n = 3–4 for each group). D The mRNA levels of rosacea-characteristic factors ( n = 3 for each group) and ( E ) CD4 + T cells infiltration ( n = 4 for each group) and CD31 + microvasculature ( n = 5 for each group) in the skin of WT or Tcrd −/− mice injected with LL37 or PBS. F The quantification of immune cells in the skin from rosacea-like mice ( n = 3 for each group). Data represent the mean ± SEM. ns, p > 0.05. Two-way ANOVA with Bonferroni’s post hoc test was used.

Article Snippet: The antimicrobial peptide LL37 was synthesized by Sangon Biotech, and the purity of LL37 was 95% by high performance liquid chromatography (HPLC).

Techniques: Staining, Injection

Journal: Nature Communications

Article Title: High-sensitive sensory neurons exacerbate rosacea-like dermatitis in mice by activating γδ T cells directly

doi: 10.1038/s41467-024-50970-1

Figure Lengend Snippet: A Diagram of the experimental paradigm in ( A – E ). Capsaicin or vehicle on day −1 before intradermal injection of LL37 in WT or Tcrd −/− mice. B Representative macroscopic images and HE-stained sections and C The redness score, area of erythema and skin thickness of skin tissues in vehicle or capsaicin-treated WT or Tcrd −/− mice after LL37 injection ( n = 5 mice for each group). D The mRNA levels of rosacea-characteristic factors and E CD4 + T cells infiltration and CD31 + microvasculature in the skin of vehicle- or capsaicin-treated WT or Tcrd −/− mice after LL37 injection ( n = 4 for each group). C – E Data represent the mean ± SEM. ns, p > 0.05. Two-way ANOVA with Bonferroni’s post hoc test was used.

Article Snippet: The antimicrobial peptide LL37 was synthesized by Sangon Biotech, and the purity of LL37 was 95% by high performance liquid chromatography (HPLC).

Techniques: Injection, Staining

Journal: Nature Communications

Article Title: High-sensitive sensory neurons exacerbate rosacea-like dermatitis in mice by activating γδ T cells directly

doi: 10.1038/s41467-024-50970-1

Figure Lengend Snippet: A Flow cytometry of IL17A + immune cells in rosacea-like skin ( n = 3 for each group). B Flow cytometry of IL17A + immune cells in the skin of γδ T-cell loss-of-function mice with LL37 injection ( n = 3 for each group). C The IL17A and RORA mRNA levels in γδ T cells after CGRP treatment ( n = 3 for each group). D Flow cytometry revealed IL17A secretin in γδ T cells after CGRP treatment ( n = 4 for each group). E GSVA analysis of the proteins in γδ T cells treated with vehicle or CGRP. F Volcano plot of DEPs determined between control and CGRP-treated γδ T cells. G Enrichment analysis of DEPs determined between control and CGRP-treated γδ T cells. Data represent the mean ± SEM. ns, p > 0.05. Two-way ANOVA with Bonferroni’s post hoc test was used.

Article Snippet: The antimicrobial peptide LL37 was synthesized by Sangon Biotech, and the purity of LL37 was 95% by high performance liquid chromatography (HPLC).

Techniques: Flow Cytometry, Injection, Control

Journal: Nature Communications

Article Title: High-sensitive sensory neurons exacerbate rosacea-like dermatitis in mice by activating γδ T cells directly

doi: 10.1038/s41467-024-50970-1

Figure Lengend Snippet: A Diagram of the experimental paradigm in ( A – E ). Mice were coadministered capsaicin with rimegepant on day −1 before intradermal injection of PBS or LL37. B Representative photo and HE staining and ( C ) The redness score, area of erythema and skin thickness of skin tissues in rimegepant and capsaicin-treated mice after LL37 injection ( n = 4 for each group). D The mRNA levels of rosacea-characteristic factors ( n = 3 or 4 for each group) and ( E ) CD4 + T cells infiltration ( n = 8 for each group) and CD31 + microvasculature ( n = 4 for each group) in the skin of rimegepant and capsaicin-treated mice after LL37 injection. Data represent the mean ± SEM. ns, p > 0.05. Two-way ANOVA test was used.

Article Snippet: The antimicrobial peptide LL37 was synthesized by Sangon Biotech, and the purity of LL37 was 95% by high performance liquid chromatography (HPLC).

Techniques: Injection, Staining

Journal: Infection and Drug Resistance

Article Title: Targeting polyelectrolyte networks in purulent body fluids to modulate bactericidal properties of some antibiotics

doi: 10.2147/IDR.S145337

Figure Lengend Snippet: Decrease of Pseudomonas aeruginosa Xen5 luminescence (indicative of decreased viability) after 8 hours of incubation with cathelicidin LL-37 ( A ), ceragenin CSA-13 ( B ), polymyxin B ( C ), tobramycin ( D ), colistin ( E ), and aztreonam ( F ) or their combination with DNase 1, p-ASP or DNase 1/p-ASP assessed in individual samples of 1:10 dilution of cystic fibrosis sputum. Error bars represent standard deviations from eight different sputum samples (n=8). *Statistically significant ( p <0.05) compared to control. Abbreviation: p-ASP, poly-(d,l)-aspartic acid.

Article Snippet: LL-37 ([LL-37, 37 aa]) was purchased from Peptide 2.0 Inc. (Chantilly, VA, USA).

Techniques: Incubation

Journal: Infection and Drug Resistance

Article Title: Targeting polyelectrolyte networks in purulent body fluids to modulate bactericidal properties of some antibiotics

doi: 10.2147/IDR.S145337

Figure Lengend Snippet: Pseudomonas aeruginosa Xen5 biofilm mass formed after 24 hours growth in LB medium containing cathelicidin LL-37 ( A ), ceragenin CSA-13 ( B ), polymyxin B ( C ), tobramycin ( D ), colistin ( E ), and aztreonam ( F ) or their combination with DNase 1, p-ASP, or DNase 1/p-ASP. Error bars represent standard deviations from three to five measurements. *Statistically significant ( p <0.05) compared to control. Abbreviations: p-ASP, poly-(d,l)-aspartic acid; LB, Luria-Bertani broth.

Article Snippet: LL-37 ([LL-37, 37 aa]) was purchased from Peptide 2.0 Inc. (Chantilly, VA, USA).

Techniques:

Journal: Infection and Drug Resistance

Article Title: Targeting polyelectrolyte networks in purulent body fluids to modulate bactericidal properties of some antibiotics

doi: 10.2147/IDR.S145337

Figure Lengend Snippet: Bacterial outgrowth from PBS ( A and B ) or PBS containing 50% pus ( C and D ) that were infected with S. aureus Xen30 and treated with ceragenin CSA-13 ( A and C ) or LL-37 peptide ( B and D ) with or without the presence of DNase 1, p-ASP, or DNase 1/p-ASP. Error bars represent standard deviations from six different pus samples (n=6). *Statistically significant ( p <0.05) compared to control. Abbreviations: p-ASP, poly-(d,l)-aspartic acid; S. aureus , Staphylococcus aureus .

Article Snippet: LL-37 ([LL-37, 37 aa]) was purchased from Peptide 2.0 Inc. (Chantilly, VA, USA).

Techniques: Infection